PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0122049.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YB
Protein Properties Length: 194aa    MW: 21934 Da    PI: 4.3857
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0122049.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB78.41e-241194386
            NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                     ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +v+se+++ c re+r+ti+++ +l al+ lGf dy+e++ + 
  Lj0g3v0122049.2 11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLVSSESNEVCGREERRTIAPEHVLKALGVLGFGDYIEEVYAA 94
                     6899***************************************************************************98654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.0E-389140IPR009072Histone-fold
SuperFamilySSF471133.91E-3512142IPR009072Histone-fold
PfamPF008082.0E-211479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MEPMDIVAKA KEDASLPKAT MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLVSSESNE  60
VCGREERRTI APEHVLKALG VLGFGDYIEE VYAAYEQHKL ETMQDTLKGA KWSNRAEMTE  120
EEALAEQQRM FAEARARMNG GTITSKEPDA DQSDVLISVS NASVVSFLAT YQIVWICFSQ  180
FRIDFNFWVF GSFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B9e-341213512133Transcription Regulator NC2 beta chain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.70500.0cell culture| pod| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1410600.0BT141060.1 Lotus japonicus clone JCVI-FLLj-2C22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014494002.11e-107PREDICTED: protein Dr1 homolog
SwissprotP495926e-89NC2B_ARATH; Protein Dr1 homolog
TrEMBLI3SKR21e-110I3SKR2_LOTJA; Uncharacterized protein
STRINGGLYMA05G07750.13e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47663358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.23e-90nuclear factor Y, subunit B13